Loading...
Statistics
Advertisement

Campement Kunja - Paradijsje in Zuid-Senegal
www.kunja.nl/

Kunja.nl

Advertisement
Conversion Technology Metas Server
Kunja.nl is hosted in Netherlands . Kunja.nl doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache/2.4.10.

Technologies in use by Kunja.nl

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache/2.4.10

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Kunja.nl

Missing HTTPS protocol.

    Meta - Kunja.nl

    Number of occurences: 0

    Server / Hosting

    • IP: 188.93.150.48
    • Latitude: 52.38
    • Longitude: 4.90
    • Country: Netherlands

    Rname

    • ns2.metaregistrar.nl
    • ns1.metaregistrar.nl
    • mailfilter1.mijndomein.nl
    • mailfilter2.mijndomein.nl

    Target

    • beheer.metaregistrar.nl

    HTTP Header Response

    HTTP/1.1 200 OK Date: Tue, 30 Aug 2016 11:43:47 GMT Server: Apache/2.4.10 Content-Length: 292 Content-Type: text/html; charset=ISO-8859-1 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

    DNS

    host: kunja.nl
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 188.93.150.48
    host: kunja.nl
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.metaregistrar.nl
    host: kunja.nl
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.metaregistrar.nl
    host: kunja.nl
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns1.metaregistrar.nl
    5. rname: beheer.metaregistrar.nl
    6. serial: 1
    7. refresh: 14400
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: kunja.nl
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 5
    5. target: mailfilter1.mijndomein.nl
    host: kunja.nl
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 6
    5. target: mailfilter2.mijndomein.nl

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.unja.nl, www.ktunja.nl, www.tunja.nl, www.kunja.nl, www.unja.nl, www.kgunja.nl, www.gunja.nl, www.kbunja.nl, www.bunja.nl, www.knunja.nl, www.nunja.nl, www.khunja.nl, www.hunja.nl, www.kyunja.nl, www.yunja.nl, www.klunja.nl, www.lunja.nl, www.kounja.nl, www.ounja.nl, www.kuunja.nl, www.uunja.nl, www.kiunja.nl, www.iunja.nl, www.kmunja.nl, www.munja.nl, www.knja.nl, www.kuwnja.nl, www.kwnja.nl, www.kuenja.nl, www.kenja.nl, www.kusnja.nl, www.ksnja.nl, www.kuanja.nl, www.kanja.nl, www.kuja.nl, www.kunnja.nl, www.kunja.nl, www.kunhja.nl, www.kuhja.nl, www.kunjja.nl, www.kujja.nl, www.kunkja.nl, www.kukja.nl, www.kunlja.nl, www.kulja.nl, www.kun ja.nl, www.ku ja.nl, www.kuna.nl, www.kunjza.nl, www.kunza.nl, www.kunjha.nl, www.kunha.nl, www.kunjna.nl, www.kunna.nl, www.kunj.a.nl, www.kun.a.nl, www.kunjua.nl, www.kunua.nl, www.kunjka.nl, www.kunka.nl, www.kunjla.nl, www.kunla.nl, www.kunjoa.nl, www.kunoa.nl, www.kunj.nl, www.kunjao.nl, www.kunjo.nl, www.kunjap.nl, www.kunjp.nl, www.kunja9.nl, www.kunj9.nl, www.kunja.nl, www.kunj.nl, www.kunjai.nl, www.kunji.nl, www.kunjau.nl, www.kunju.nl,

    Other websites we recently analyzed

    1. edirneevdenevenakliyatfirmalari.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    2. uda.wang
      Chai Wan (Hong Kong) - 103.51.144.89
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    3. Дмитрий Чубаров
      San Francisco (United States) - 208.93.0.150
      Server software: squid/3.5.14
      Technology: AdFox, DoubleClick.Net, CSS, Html, Html5, Iframe, Javascript, Php, SVG, Yandex.Metrika, comScore, Google Analytics, Google Tagmanager
      Number of Javascript: 5
      Number of meta tags: 2
    4. KillerLabs
      Brea (United States) - 69.163.186.251
      Server software: Apache
      Technology: CSS, Html
    5. holywoodhillscountryhouse.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    6. Serwis Elektryczny Wrocław 24h - tel. 71 307-43-48
      Profesjonalne usługi elektryczne we Wrocławiu i okolicach. Obsługujemy klientów indywidualnych, firmy i instytucje. Zapraszam!
      Poland - 185.49.15.237
      Server software: Apache/2
      Technology: CSS, Fancybox, Google Font API, Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 5
    7. whyusethem.com
      Scottsdale (United States) - 184.168.221.40
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    8. naranjas10.com
      Germany - 217.160.230.123
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    9. leuchtrahmen.de
      Hamburg (Germany) - 84.46.92.229
      Server software: Apache/2.2.9 (Debian)
      Technology: Html
      Number of meta tags: 1
    10. 86873.date
      China - 124.16.31.156
      Server software: Tengine/1.4.2
      Technology: CloudFront, Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1

    Check Other Websites